PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G12730.1
Common NameLOC102712018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 292aa    MW: 32278.3 Da    PI: 9.811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G12730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.5e-092973346
                     SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqk 46
                     +W++eE +++ +a + l  +  +W+++ar ++ gR+  ++ s++ +
     OB01G12730.1 29 KWSPEENKQFERALAGLDLRcpDWDKVARAIP-GRSVIEVMSHFKD 73
                     8*****************99************.**********987 PP

2Myb_DNA-binding48.12.6e-15145189347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
     OB01G12730.1 145 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 189
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.752579IPR017884SANT domain
SMARTSM007179.2E-52677IPR001005SANT/Myb domain
PfamPF002493.7E-72974IPR001005SANT/Myb domain
SuperFamilySSF466897.48E-92982IPR009057Homeodomain-like
CDDcd001674.63E-72974No hitNo description
PROSITE profilePS5129418.359138194IPR017930Myb domain
SuperFamilySSF466896.21E-18139194IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-17141192IPR006447Myb domain, plants
SMARTSM007173.4E-13142192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-12142188IPR009057Homeodomain-like
CDDcd001677.46E-12145190No hitNo description
PfamPF002499.8E-13145189IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMRDAYMEVL PPMDHYASRG NWFMPPPRKW SPEENKQFER ALAGLDLRCP DWDKVARAIP  60
GRSVIEVMSH FKDLELDVQQ IENGMVPFPV YAPGGGGGGG AFTLQWDGSG GHGVGDFRNA  120
YRFGGGGGKR HFGRTPEQER KKGVPWTEEE HKLFLLGLKK YGKGDWRNIS RNFVQTRTPT  180
QVASHAQKYF IRLNSGGKDK RRSSIHDITT VNLTDDRPPS PSQSLITNQS NTAVAPYSST  240
SDVKPQNAAN ASFNSPSRTL GMPAYGMGLQ DQGLQCGGPL HDQLAASRSI LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-142896978RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679640.0AK067964.1 Oryza sativa Japonica Group cDNA clone:J013124L02, full insert sequence.
GenBankEU8372500.0EU837250.1 Oryza sativa Japonica Group clone KCB707G04 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643740.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-81DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLJ3KWB70.0J3KWB7_ORYBR; Uncharacterized protein
STRINGOB01G12730.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.17e-64MYB family protein